Lineage for d1cl8a_ (1cl8 A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 397005Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 397006Superfamily c.52.1: Restriction endonuclease-like [52980] (22 families) (S)
  5. 397007Family c.52.1.1: Restriction endonuclease EcoRI [52981] (1 protein)
  6. 397008Protein Restriction endonuclease EcoRI [52982] (1 species)
  7. 397009Species Escherichia coli [TaxId:562] [52983] (7 PDB entries)
  8. 397011Domain d1cl8a_: 1cl8 A: [33230]
    complexed with prn

Details for d1cl8a_

PDB Entry: 1cl8 (more details), 1.8 Å

PDB Description: a pre-transition state eco ri endonuclease/cognate dna (tcgcgapttcgcg) complex with dna base analog purine (p)

SCOP Domain Sequences for d1cl8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cl8a_ c.52.1.1 (A:) Restriction endonuclease EcoRI {Escherichia coli}
sqgvigifgdyakahdlavgevsklvkkalsneypqlsfryrdsikkteinealkkidpd
lggtlfvsnssikpdggivevkddygewrvvlvaeakhqgkdiinirngllvgkrgdqdl
maagnaiershkniseianfmlseshfpyvlflegsnfltenisitrpdgrvvnleynsg
ilnrldrltaanygmpinsnlcinkfvnhkdksimlqaasiytqgdgrewdskimfeimf
disttslrvlgrdlfeqltsk

SCOP Domain Coordinates for d1cl8a_:

Click to download the PDB-style file with coordinates for d1cl8a_.
(The format of our PDB-style files is described here.)

Timeline for d1cl8a_: