Lineage for d5v38b1 (5v38 B:862-1071)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2780769Species Clostridium botulinum [TaxId:1491] [225675] (24 PDB entries)
  8. 2780783Domain d5v38b1: 5v38 B:862-1071 [332279]
    Other proteins in same PDB: d5v38a2, d5v38b2
    automated match to d2vuaa1
    complexed with acy

Details for d5v38b1

PDB Entry: 5v38 (more details), 1.8 Å

PDB Description: crystal structure of the receptor-binding domain of botulinum neurotoxin type ha
PDB Compounds: (B:) HcHA

SCOPe Domain Sequences for d5v38b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5v38b1 b.29.1.0 (B:862-1071) automated matches {Clostridium botulinum [TaxId: 1491]}
kyncilnikyemdrdklvdssgyrsrinigtgvkfseidknqvqlsnlesskievilnng
viynsmyenfstsfwiripkyfrninneykiiscmqnnsgwevslnfsnmnskiiwtlqd
tegikktvvfqytqninisdyinrwifvtitnnrlsnskiyingrlineesisdlgniha
snnimfkldgcrdphryiwikyfnlfdkel

SCOPe Domain Coordinates for d5v38b1:

Click to download the PDB-style file with coordinates for d5v38b1.
(The format of our PDB-style files is described here.)

Timeline for d5v38b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5v38b2