| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) ![]() |
| Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
| Protein automated matches [190131] (86 species) not a true protein |
| Species Paenisporosarcina sp. [TaxId:1231057] [332209] (2 PDB entries) |
| Domain d5wq0e_: 5wq0 E: [332273] automated match to d2mska_ complexed with mg |
PDB Entry: 5wq0 (more details), 2.6 Å
SCOPe Domain Sequences for d5wq0e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5wq0e_ c.23.1.0 (E:) automated matches {Paenisporosarcina sp. [TaxId: 1231057]}
ekikvaiaddnkelvktlesyladhpqievittapngkvilslmendlpdvllldiimph
ldglavlemmqanenlskvqvimltafgqedvmkqavdlgasyfmlkpfefdrlvnqilq
vag
Timeline for d5wq0e_: