Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
Superfamily c.51.4: ITPase-like [52972] (4 families) formerly Maf/Ham1; elaborated with additional structures inserted in the common fold |
Family c.51.4.2: Maf-like [52976] (3 proteins) automatically mapped to Pfam PF02545 |
Protein Maf protein [52977] (1 species) |
Species Bacillus subtilis [TaxId:1423] [52978] (2 PDB entries) |
Domain d1ex2b_: 1ex2 B: [33226] complexed with po4, suc |
PDB Entry: 1ex2 (more details), 1.85 Å
SCOPe Domain Sequences for d1ex2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ex2b_ c.51.4.2 (B:) Maf protein {Bacillus subtilis [TaxId: 1423]} mtkplilasqsprrkelldllqlpysiivseveeklnrnfspeenvqwlakqkakavadl hphaivigadtmvcldgeclgkpqdqeeaasmlrrlsgrshsvitavsiqaenhsetfyd ktevafwslseeeiwtyietkepmdkagaygiqgrgalfvkkidgdyysvmglpisktmr alrhf
Timeline for d1ex2b_: