SCOPe 2.07: Domain d5uwpb_: 5uwp B:

Lineage for d5uwpb_ (5uwp B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.0: automated matches [191311] (1 protein)
   not a true family

6. Protein automated matches [190052] (8 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [194506] (62 PDB entries)

8. Domain d5uwpb_: 5uwp B: [332259]
   Other proteins in same PDB: d5uwpa_
   automated match to d4wvfb_
   complexed with gnp, gol, mg

Details for d5uwpb_

PDB Entry: 5uwp, 2.05 Å

PDB Description: crystal structure of mdia2 nes peptide in complex with crm1-ran-ranbp1

PDB Compounds: (B:) Ran-specific GTPase-activating protein 1

SCOPe Domain Sequences for d5uwpb_:

Sequence, based on SEQRES records:

>d5uwpb_ b.55.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
hfepvvhlekvdvktmeedeevlykvraklfrfdadakewkergtgdckflknkktnkvr
ilmrrdktlkicanhiiapeytlkpnvgsdrswvyactadiaegeaeaftfairfgsken
adkfkeefekaqeinkk

Sequence, based on observed residues (ATOM records):

>d5uwpb_ b.55.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
hfepvtmeedeevlykvraklfrfdadakewkergtgdckflknkktnkvrilmrrdktl
kicanhiiapeytlkpnvgsdrswvyactadiaegeaeaftfairfgskenadkfkeefe
kaqeinkk

Timeline for d5uwpb_:

• d5uwpb_ first appeared in SCOPe 2.06
  
• d5uwpb_ appears in the current release, SCOPe 2.08