SCOPe 2.06: Domain d5uwtb_: 5uwt B:

Lineage for d5uwtb_ (5uwt B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.0: automated matches [191311] (1 protein)
   not a true family

6. Protein automated matches [190052] (6 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [194506] (31 PDB entries)

8. Domain d5uwtb_: 5uwt B: [332251]
   Other proteins in same PDB: d5uwta_
   automated match to d4wvfb_
   complexed with gnp, gol, mg; mutant

Details for d5uwtb_

PDB Entry: 5uwt, 2.34 Å

PDB Description: crystal structure of hxk2 peptide in complex with crm1 k579a mutant- ran-ranbp1

PDB Compounds: (B:) Ran-specific GTPase-activating protein 1

SCOPe Domain Sequences for d5uwtb_:

Sequence, based on SEQRES records:

>d5uwtb_ b.55.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
fepvvhlekvdvktmeedeevlykvraklfrfdadakewkergtgdckflknkktnkvri
lmrrdktlkicanhiiapeytlkpnvgsdrswvyactadiaegeaeaftfairfgskena
dkfkeefekaqeinkk

Sequence, based on observed residues (ATOM records):

>d5uwtb_ b.55.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
fepvtmeedeevlykvraklfrfdadakewkergtgdckflknkktnkvrilmrrdktlk
icanhiiapeytlkpnvgsdrswvyactadiaegeaeaftfairfgskenadkfkeefek
aqeinkk

Timeline for d5uwtb_:

• d5uwtb_ is new in SCOPe 2.06-stable
  
• d5uwtb_ appears in SCOPe 2.07
  
• d5uwtb_ appears in the current release, SCOPe 2.08