Lineage for d2mjpb_ (2mjp B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1856157Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 1856374Superfamily c.51.4: ITPase-like [52972] (4 families) (S)
    formerly Maf/Ham1; elaborated with additional structures inserted in the common fold
  5. 1856375Family c.51.4.1: ITPase (Ham1) [52973] (4 proteins)
    Pfam PF01725
  6. 1856390Protein XTP pyrophosphatase [52974] (2 species)
  7. 1856391Species Methanococcus jannaschii [TaxId:2190] [52975] (2 PDB entries)
    MJ0226
  8. 1856395Domain d2mjpb_: 2mjp B: [33224]
    structural genomics
    complexed with anp

Details for d2mjpb_

PDB Entry: 2mjp (more details), 2.2 Å

PDB Description: structure-based identification of the biochemical function of a hypothetical protein from methanococcus jannaschii:mj0226
PDB Compounds: (B:) pyrophosphatase

SCOPe Domain Sequences for d2mjpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mjpb_ c.51.4.1 (B:) XTP pyrophosphatase {Methanococcus jannaschii [TaxId: 2190]}
kiyfatgnpnkikeaniilkdlkdveieqikisypeiqgtleevaefgakwvynilkkpv
ivedsgffvealngfpgtyskfvqetignegilkllegkdnrnayfktvigycdengvrl
fkgivkgrvseeirskgygfaydsifipeeeertfaemtteeksqishrkkafeefkkfl
ldri

SCOPe Domain Coordinates for d2mjpb_:

Click to download the PDB-style file with coordinates for d2mjpb_.
(The format of our PDB-style files is described here.)

Timeline for d2mjpb_: