SCOPe 2.08: Domain d5uv2a1: 5uv2 A:61-263

Lineage for d5uv2a1 (5uv2 A:61-263)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families)

5. Family a.102.4.0: automated matches [227201] (1 protein)
   not a true family

6. Protein automated matches [226931] (12 species)
   not a true protein

7. Species Citrus sinensis [TaxId:2711] [332182] (4 PDB entries)

8. Domain d5uv2a1: 5uv2 A:61-263 [332239]
   Other proteins in same PDB: d5uv2a2
   automated match to d3n0fa1
   complexed with la6, mn

Details for d5uv2a1

PDB Entry: 5uv2, 2.2 Å

PDB Description: crystal structure of (+)-limonene synthase complexed with 2- fluoroneryl diphosphate

PDB Compounds: (A:) (+)-limonene synthase

SCOPe Domain Sequences for d5uv2a1:

Sequence, based on SEQRES records:

>d5uv2a1 a.102.4.0 (A:61-263) automated matches {Citrus sinensis [TaxId: 2711]}
siwdhdflqslnsnytdetykrraeelkgkvktaikdvtepldqlelidnlqrlglayhf
epeirnilrnihnhnkdynwrkenlyatslefrllrqhgypvsqevfsgfkddkvgficd
dfkgilslheasyyslegesimeeawqftskhlkemmitsnskeedvfvaeqakralelp
lhwkapmlearwfihvyekredk

Sequence, based on observed residues (ATOM records):

>d5uv2a1 a.102.4.0 (A:61-263) automated matches {Citrus sinensis [TaxId: 2711]}
siwdhdflqslnsnytdetykrraeelkgkvktaikdvtepldqlelidnlqrlglayhf
epeirnilrnihnhnkdynwrkenlyatslefrllrqhgypvsqevfsgfkddkvgficd
dfkgilslheasyyslegesimeeawqftskhlkemmidvfvaeqakralelplhwkapm
learwfihvyekredk

Timeline for d5uv2a1:

• d5uv2a1 first appeared in SCOPe 2.06
  
• d5uv2a1 appears in SCOPe 2.07