![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.31: Cdc48 domain 2-like [54584] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
![]() | Superfamily d.31.1: Cdc48 domain 2-like [54585] (2 families) ![]() |
![]() | Family d.31.1.1: Cdc48 domain 2-like [54586] (4 proteins) |
![]() | Protein Membrane fusion atpase p97 domain 2, P97-Nc [64254] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [233318] (13 PDB entries) |
![]() | Domain d5x4lb2: 5x4l B:107-191 [332233] Other proteins in same PDB: d5x4la1, d5x4la3, d5x4lb1, d5x4lc_, d5x4ld_ automated match to d5dyga2 |
PDB Entry: 5x4l (more details), 2.4 Å
SCOPe Domain Sequences for d5x4lb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5x4lb2 d.31.1.1 (B:107-191) Membrane fusion atpase p97 domain 2, P97-Nc {Human (Homo sapiens) [TaxId: 9606]} dvkygkrihvlpiddtvegitgnlfevylkpyfleayrpirkgdiflvrggmravefkvv etdpspycivapdtvihcegepikr
Timeline for d5x4lb2: