Lineage for d5x4lb1 (5x4l B:24-106)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2802576Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 2802649Superfamily b.52.2: ADC-like [50692] (4 families) (S)
  5. 2802794Family b.52.2.3: Cdc48 N-terminal domain-like [50708] (4 proteins)
  6. 2802795Protein Membrane fusion ATPase p97 N-terminal domain , P97-Nn [63796] (2 species)
  7. 2802796Species Human (Homo sapiens) [TaxId:9606] [233316] (13 PDB entries)
  8. 2802812Domain d5x4lb1: 5x4l B:24-106 [332232]
    Other proteins in same PDB: d5x4la2, d5x4la3, d5x4lb2, d5x4lc_, d5x4ld_
    automated match to d5dyga1

Details for d5x4lb1

PDB Entry: 5x4l (more details), 2.4 Å

PDB Description: crystal structure of the ubx domain of human ubxd7 in complex with p97 n domain
PDB Compounds: (B:) Transitional endoplasmic reticulum ATPase

SCOPe Domain Sequences for d5x4lb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5x4lb1 b.52.2.3 (B:24-106) Membrane fusion ATPase p97 N-terminal domain , P97-Nn {Human (Homo sapiens) [TaxId: 9606]}
nrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivlsddtcsdekir
mnrvvrnnlrvrlgdvisiqpcp

SCOPe Domain Coordinates for d5x4lb1:

Click to download the PDB-style file with coordinates for d5x4lb1.
(The format of our PDB-style files is described here.)

Timeline for d5x4lb1: