Lineage for d2mjpa_ (2mjp A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies) 
Superfamily c.51.4: Maf/Ham1 [52972] (2 families) 
Family c.51.4.1: Ham1 [52973] (1 protein) Protein XTP pyrophosphatase [52974] (1 species) Species Methanococcus jannaschii [TaxId:2190] [52975] (2 PDB entries) 
Domain d2mjpa_: 2mjp A: [33223]
Details for d2mjpa_
PDB Entry: 2mjp (more details), 2.2 Å
PDB Description: structure-based identification of the biochemical function of a hypothetical protein from methanococcus jannaschii:mj0226
SCOP Domain Sequences for d2mjpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mjpa_ c.51.4.1 (A:) XTP pyrophosphatase {Methanococcus jannaschii}
kiyfatgnpnkikeaniilkdlkdveieqikisypeiqgtleevaefgakwvynilkkpv
ivedsgffvealngfpgtyskfvqetignegilkllegkdnrnayfktvigycdengvrl
fkgivkgrvseeirskgygfaydsifipeeeertfaemtteeksqishrkkafeefkkfl
ldri
SCOP Domain Coordinates for d2mjpa_:
Click to download the PDB-style file with coordinates for d2mjpa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2mjpa_:
- d2mjpa_ appears in SCOP 1.57
- d2mjpa_ appears in the current release, SCOPe 2.08
View in 3D
