| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
Superfamily c.51.4: ITPase-like [52972] (4 families) ![]() formerly Maf/Ham1; elaborated with additional structures inserted in the common fold |
| Family c.51.4.1: ITPase (Ham1) [52973] (4 proteins) Pfam PF01725 |
| Protein XTP pyrophosphatase [52974] (2 species) |
| Species Methanococcus jannaschii [TaxId:2190] [52975] (2 PDB entries) MJ0226 |
| Domain d2mjpa_: 2mjp A: [33223] structural genomics complexed with anp |
PDB Entry: 2mjp (more details), 2.2 Å
SCOPe Domain Sequences for d2mjpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mjpa_ c.51.4.1 (A:) XTP pyrophosphatase {Methanococcus jannaschii [TaxId: 2190]}
kiyfatgnpnkikeaniilkdlkdveieqikisypeiqgtleevaefgakwvynilkkpv
ivedsgffvealngfpgtyskfvqetignegilkllegkdnrnayfktvigycdengvrl
fkgivkgrvseeirskgygfaydsifipeeeertfaemtteeksqishrkkafeefkkfl
ldri
Timeline for d2mjpa_: