SCOPe 2.06: Domain d1b78a_: 1b78 A:

Lineage for d1b78a_ (1b78 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.4: ITPase-like [52972] (4 families)
   formerly Maf/Ham1; elaborated with additional structures inserted in the common fold

5. Family c.51.4.1: ITPase (Ham1) [52973] (4 proteins)
   Pfam PF01725

6. Protein XTP pyrophosphatase [52974] (2 species)

7. Species Methanococcus jannaschii [TaxId:2190] [52975] (2 PDB entries)
   MJ0226

8. Domain d1b78a_: 1b78 A: [33221]

Details for d1b78a_

PDB Entry: 1b78, 2.2 Å

PDB Description: structure-based identification of the biochemical function of a hypothetical protein from methanococcus jannaschii:mj0226

PDB Compounds: (A:) pyrophosphatase

SCOPe Domain Sequences for d1b78a_:

Sequence; same for both SEQRES and ATOM records:

>d1b78a_ c.51.4.1 (A:) XTP pyrophosphatase {Methanococcus jannaschii [TaxId: 2190]}
kiyfatgnpnkikeaniilkdlkdveieqikisypeiqgtleevaefgakwvynilkkpv
ivedsgffvealngfpgtyskfvqetignegilkllegkdnrnayfktvigycdengvrl
fkgivkgrvseeirskgygfaydsifipeeeertfaemtteeksqishrkkafeefkkfl
ldri

Timeline for d1b78a_:

• d1b78a_ first appeared (with stable ids) in SCOP 1.55
  
• d1b78a_ appears in SCOPe 2.05
  
• d1b78a_ appears in SCOPe 2.07
  
• d1b78a_ appears in the current release, SCOPe 2.08