Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies) |
Superfamily c.51.4: Maf/Ham1 [52972] (2 families) |
Family c.51.4.1: Ham1 [52973] (1 protein) |
Protein XTP pyrophosphatase [52974] (1 species) |
Species Methanococcus jannaschii [TaxId:2190] [52975] (2 PDB entries) |
Domain d1b78a_: 1b78 A: [33221] |
PDB Entry: 1b78 (more details), 2.2 Å
SCOP Domain Sequences for d1b78a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b78a_ c.51.4.1 (A:) XTP pyrophosphatase {Methanococcus jannaschii} kiyfatgnpnkikeaniilkdlkdveieqikisypeiqgtleevaefgakwvynilkkpv ivedsgffvealngfpgtyskfvqetignegilkllegkdnrnayfktvigycdengvrl fkgivkgrvseeirskgygfaydsifipeeeertfaemtteeksqishrkkafeefkkfl ldri
Timeline for d1b78a_: