Lineage for d1b78a_ (1b78 A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24691Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies)
  4. 24757Superfamily c.51.4: Maf/Ham1 [52972] (2 families) (S)
  5. 24758Family c.51.4.1: Ham1 [52973] (1 protein)
  6. 24759Protein XTP pyrophosphatase [52974] (1 species)
  7. 24760Species Methanococcus jannaschii [TaxId:2190] [52975] (2 PDB entries)
  8. 24761Domain d1b78a_: 1b78 A: [33221]

Details for d1b78a_

PDB Entry: 1b78 (more details), 2.2 Å

PDB Description: structure-based identification of the biochemical function of a hypothetical protein from methanococcus jannaschii:mj0226

SCOP Domain Sequences for d1b78a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b78a_ c.51.4.1 (A:) XTP pyrophosphatase {Methanococcus jannaschii}
kiyfatgnpnkikeaniilkdlkdveieqikisypeiqgtleevaefgakwvynilkkpv
ivedsgffvealngfpgtyskfvqetignegilkllegkdnrnayfktvigycdengvrl
fkgivkgrvseeirskgygfaydsifipeeeertfaemtteeksqishrkkafeefkkfl
ldri

SCOP Domain Coordinates for d1b78a_:

Click to download the PDB-style file with coordinates for d1b78a_.
(The format of our PDB-style files is described here.)

Timeline for d1b78a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1b78b_