SCOPe 2.05: Domain d1diob_: 1dio B:

Lineage for d1diob_ (1dio B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.3: B12-dependent dehydatase associated subunit [52968] (2 families)

5. Family c.51.3.1: Diol dehydratase, beta subunit [52969] (1 protein)
   contains additional structures in the C-terminal extension

6. Protein Diol dehydratase, beta subunit [52970] (2 species)

7. Species Klebsiella oxytoca [TaxId:571] [52971] (8 PDB entries)

8. Domain d1diob_: 1dio B: [33219]
   Other proteins in same PDB: d1dioa_, d1diog_, d1diol_, d1diom_
   complexed with b12, k, pgo

Details for d1diob_

PDB Entry: 1dio, 2.2 Å

PDB Description: diol dehydratase-cyanocobalamin complex from klebsiella oxytoca

PDB Compounds: (B:) protein (diol dehydratase)

SCOPe Domain Sequences for d1diob_:

Sequence; same for both SEQRES and ATOM records:

>d1diob_ c.51.3.1 (B:) Diol dehydratase, beta subunit {Klebsiella oxytoca [TaxId: 571]}
gfltevgearqgtqqdeviiavgpafglaqtvnivgiphksilreviagieeegikarvi
rcfkssdvafvavegnrlsgsgisigiqskgttvihqqglpplsnlelfpqaplltlety
rqigknaaryakrespqpvptlndqmarpkyqaksailhiketkyvvtgknpqelrval

Timeline for d1diob_:

• d1diob_ first appeared (with stable ids) in SCOP 1.55
  
• d1diob_ appears in SCOPe 2.04
  
• d1diob_ appears in SCOPe 2.06
  
• d1diob_ appears in the current release, SCOPe 2.08