Lineage for d1egme_ (1egm E:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies) 
Superfamily c.51.3: Diol dehydratase, beta subunit [52968] (1 family) 
Family c.51.3.1: Diol dehydratase, beta subunit [52969] (1 protein) Protein Diol dehydratase, beta subunit [52970] (1 species) Species Klebsiella oxytoca [TaxId:571] [52971] (4 PDB entries) 
Domain d1egme_: 1egm E: [33218]
Other proteins in same PDB: d1egma_, d1egmg_, d1egml_, d1egmm_
Details for d1egme_
PDB Entry: 1egm (more details), 1.85 Å
PDB Description: crystal structure of diol dehydratase-cyanocobalamin complex at 100k.
SCOP Domain Sequences for d1egme_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1egme_ c.51.3.1 (E:) Diol dehydratase, beta subunit {Klebsiella oxytoca}
gfltevgearqgtqqdeviiavgpafglaqtvnivgiphksilreviagieeegikarvi
rcfkssdvafvavegnrlsgsgisigiqskgttvihqqglpplsnlelfpqaplltlety
rqigknaaryakrespqpvptlndqmarpkyqaksailhiketkyvvtgknpqelrv
SCOP Domain Coordinates for d1egme_:
Click to download the PDB-style file with coordinates for d1egme_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1egme_:
- d1egme_ appears in SCOP 1.57
- d1egme_ appears in the current release, SCOPe 2.08
View in 3D
