Lineage for d5tz3a1 (5tz3 A:579-916)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736615Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2736616Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) (S)
  5. 2737183Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. 2737184Protein automated matches [190983] (12 species)
    not a true protein
  7. 2737203Species Human (Homo sapiens) [TaxId:9606] [188676] (139 PDB entries)
  8. 2737302Domain d5tz3a1: 5tz3 A:579-916 [332159]
    Other proteins in same PDB: d5tz3a2, d5tz3b2
    automated match to d4d09a_
    complexed with 7om, mg, zn

Details for d5tz3a1

PDB Entry: 5tz3 (more details), 1.72 Å

PDB Description: crystal structure of human phosphodiesterase 2a in complex with [1,2, 4]triazolo[1,5-a]pyrimidin-7-yl}-n-(naphthalene-2-yl)piperidine-3- carboxamide
PDB Compounds: (A:) cGMP-dependent 3',5'-cyclic phosphodiesterase

SCOPe Domain Sequences for d5tz3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tz3a1 a.211.1.0 (A:579-916) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ddeytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykidcpt
larfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmchdl
dhrgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyqrml
dlmrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkgwkt
trkiaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllqdlf
pkaaelyervasnrehwtkvshkftirglpsnnsldfl

SCOPe Domain Coordinates for d5tz3a1:

Click to download the PDB-style file with coordinates for d5tz3a1.
(The format of our PDB-style files is described here.)

Timeline for d5tz3a1: