![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
![]() | Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) ![]() |
![]() | Family a.211.1.0: automated matches [191566] (1 protein) not a true family |
![]() | Protein automated matches [190983] (12 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188676] (139 PDB entries) |
![]() | Domain d5tz3a1: 5tz3 A:579-916 [332159] Other proteins in same PDB: d5tz3a2, d5tz3b2 automated match to d4d09a_ complexed with 7om, mg, zn |
PDB Entry: 5tz3 (more details), 1.72 Å
SCOPe Domain Sequences for d5tz3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5tz3a1 a.211.1.0 (A:579-916) automated matches {Human (Homo sapiens) [TaxId: 9606]} ddeytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykidcpt larfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmchdl dhrgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyqrml dlmrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkgwkt trkiaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllqdlf pkaaelyervasnrehwtkvshkftirglpsnnsldfl
Timeline for d5tz3a1:
![]() Domains from other chains: (mouse over for more information) d5tz3b1, d5tz3b2, d5tz3c_, d5tz3d_ |