Lineage for d1eexe_ (1eex E:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24691Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies)
  4. 24745Superfamily c.51.3: Diol dehydratase, beta subunit [52968] (1 family) (S)
  5. 24746Family c.51.3.1: Diol dehydratase, beta subunit [52969] (1 protein)
  6. 24747Protein Diol dehydratase, beta subunit [52970] (1 species)
  7. 24748Species Klebsiella oxytoca [TaxId:571] [52971] (4 PDB entries)
  8. 24750Domain d1eexe_: 1eex E: [33214]
    Other proteins in same PDB: d1eexa_, d1eexg_, d1eexl_, d1eexm_

Details for d1eexe_

PDB Entry: 1eex (more details), 1.7 Å

PDB Description: crystal structure of the diol dehydratase-adeninylpentylcobalamin complex from klebsiella oxytoca

SCOP Domain Sequences for d1eexe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eexe_ c.51.3.1 (E:) Diol dehydratase, beta subunit {Klebsiella oxytoca}
gfltevgearqgtqqdeviiavgpafglaqtvnivgiphksilreviagieeegikarvi
rcfkssdvafvavegnrlsgsgisigiqskgttvihqqglpplsnlelfpqaplltlety
rqigknaaryakrespqpvptlndqmarpkyqaksailhiketkyvvtgknpqelrva

SCOP Domain Coordinates for d1eexe_:

Click to download the PDB-style file with coordinates for d1eexe_.
(The format of our PDB-style files is described here.)

Timeline for d1eexe_: