Class a: All alpha proteins [46456] (289 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) covalently-bound heme completes the core |
Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
Protein Mitochondrial cytochrome c [46642] (7 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (71 PDB entries) Uniprot P00044 |
Domain d5klua_: 5klu A: [332121] automated match to d4mu8a_ complexed with 6uz, hem, so4 |
PDB Entry: 5klu (more details), 1.99 Å
SCOPe Domain Sequences for d5klua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5klua_ a.3.1.1 (A:) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} gsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikknvlwd ennmseyltnpakyipgtkmafgglkkekdrndlitylkkase
Timeline for d5klua_: