Lineage for d1c5ka2 (1c5k A:35-162)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2489766Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 2489935Superfamily c.51.2: TolB, N-terminal domain [52964] (2 families) (S)
  5. 2489936Family c.51.2.1: TolB, N-terminal domain [52965] (1 protein)
  6. 2489937Protein TolB, N-terminal domain [52966] (1 species)
  7. 2489938Species Escherichia coli [TaxId:562] [52967] (4 PDB entries)
  8. 2489948Domain d1c5ka2: 1c5k A:35-162 [33212]
    Other proteins in same PDB: d1c5ka1
    complexed with yb

Details for d1c5ka2

PDB Entry: 1c5k (more details), 2 Å

PDB Description: the structure of tolb, an essential component of the tol-dependent translocation system and its interactions with the translocation domain of colicin e9
PDB Compounds: (A:) protein (tolb protein)

SCOPe Domain Sequences for d1c5ka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c5ka2 c.51.2.1 (A:35-162) TolB, N-terminal domain {Escherichia coli [TaxId: 562]}
grpigvvpfqwagpgaapediggivaadlrnsgkfnpldrarlpqqpgsaqevqpaawsa
lgidavvvgqvtpnpdgsynvayqlvdtggapgtvlaqnsykvnkqwlryaghtasdevf
ekltgikg

SCOPe Domain Coordinates for d1c5ka2:

Click to download the PDB-style file with coordinates for d1c5ka2.
(The format of our PDB-style files is described here.)

Timeline for d1c5ka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1c5ka1