SCOP 1.73: Domain d1c5ka2: 1c5k A:35-162

Lineage for d1c5ka2 (1c5k A:35-162)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (5 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.2: TolB, N-terminal domain [52964] (1 family)

5. Family c.51.2.1: TolB, N-terminal domain [52965] (1 protein)

6. Protein TolB, N-terminal domain [52966] (1 species)

7. Species Escherichia coli [TaxId:562] [52967] (4 PDB entries)

8. Domain d1c5ka2: 1c5k A:35-162 [33212]
   Other proteins in same PDB: d1c5ka1
   complexed with yb

Details for d1c5ka2

PDB Entry: 1c5k, 2 Å

PDB Description: the structure of tolb, an essential component of the tol-dependent translocation system and its interactions with the translocation domain of colicin e9

PDB Compounds: (A:) protein (tolb protein)

SCOP Domain Sequences for d1c5ka2:

Sequence; same for both SEQRES and ATOM records:

>d1c5ka2 c.51.2.1 (A:35-162) TolB, N-terminal domain {Escherichia coli [TaxId: 562]}
grpigvvpfqwagpgaapediggivaadlrnsgkfnpldrarlpqqpgsaqevqpaawsa
lgidavvvgqvtpnpdgsynvayqlvdtggapgtvlaqnsykvnkqwlryaghtasdevf
ekltgikg

Timeline for d1c5ka2:

• d1c5ka2 first appeared (with stable ids) in SCOP 1.55
  
• d1c5ka2 appears in SCOP 1.71
  
• d1c5ka2 appears in SCOP 1.75
  
• d1c5ka2 appears in the current release, SCOPe 2.08