Lineage for d1c5ka2 (1c5k A:35-162)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 71421Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies)
  4. 71494Superfamily c.51.2: TolB, N-terminal domain [52964] (1 family) (S)
  5. 71495Family c.51.2.1: TolB, N-terminal domain [52965] (1 protein)
  6. 71496Protein TolB, N-terminal domain [52966] (1 species)
  7. 71497Species Escherichia coli [TaxId:562] [52967] (2 PDB entries)
  8. 71499Domain d1c5ka2: 1c5k A:35-162 [33212]
    Other proteins in same PDB: d1c5ka1

Details for d1c5ka2

PDB Entry: 1c5k (more details), 2 Å

PDB Description: the structure of tolb, an essential component of the tol-dependent translocation system and its interactions with the translocation domain of colicin e9

SCOP Domain Sequences for d1c5ka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c5ka2 c.51.2.1 (A:35-162) TolB, N-terminal domain {Escherichia coli}
grpigvvpfqwagpgaapediggivaadlrnsgkfnpldrarlpqqpgsaqevqpaawsa
lgidavvvgqvtpnpdgsynvayqlvdtggapgtvlaqnsykvnkqwlryaghtasdevf
ekltgikg

SCOP Domain Coordinates for d1c5ka2:

Click to download the PDB-style file with coordinates for d1c5ka2.
(The format of our PDB-style files is described here.)

Timeline for d1c5ka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1c5ka1