SCOP 1.75: Domain d1crza2: 1crz A:7-140

Lineage for d1crza2 (1crz A:7-140)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.2: TolB, N-terminal domain [52964] (1 family)

5. Family c.51.2.1: TolB, N-terminal domain [52965] (1 protein)

6. Protein TolB, N-terminal domain [52966] (1 species)

7. Species Escherichia coli [TaxId:562] [52967] (4 PDB entries)

8. Domain d1crza2: 1crz A:7-140 [33211]
   Other proteins in same PDB: d1crza1

Details for d1crza2

PDB Entry: 1crz, 1.95 Å

PDB Description: crystal structure of the e. coli tolb protein

PDB Compounds: (A:) tolb protein

SCOP Domain Sequences for d1crza2:

Sequence; same for both SEQRES and ATOM records:

>d1crza2 c.51.2.1 (A:7-140) TolB, N-terminal domain {Escherichia coli [TaxId: 562]}
dsgvdsgrpigvvpfqwagpgaapediggivaadlrnsgkfnpldrarlpqqpgsaqevq
paawsalgidavvvgqvtpnpdgsynvayqlvdtggapgtvlaqnsykvnkqwlryaght
asdevfekltgikg

Timeline for d1crza2:

• d1crza2 first appeared (with stable ids) in SCOP 1.55
  
• d1crza2 appears in SCOP 1.73
  
• d1crza2 appears in SCOPe 2.01
  
• d1crza2 appears in the current release, SCOPe 2.08