Lineage for d1crza2 (1crz A:7-140)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2881870Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 2882039Superfamily c.51.2: TolB, N-terminal domain [52964] (2 families) (S)
  5. 2882040Family c.51.2.1: TolB, N-terminal domain [52965] (1 protein)
  6. 2882041Protein TolB, N-terminal domain [52966] (1 species)
  7. 2882042Species Escherichia coli [TaxId:562] [52967] (4 PDB entries)
  8. 2882052Domain d1crza2: 1crz A:7-140 [33211]
    Other proteins in same PDB: d1crza1

Details for d1crza2

PDB Entry: 1crz (more details), 1.95 Å

PDB Description: crystal structure of the e. coli tolb protein
PDB Compounds: (A:) tolb protein

SCOPe Domain Sequences for d1crza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1crza2 c.51.2.1 (A:7-140) TolB, N-terminal domain {Escherichia coli [TaxId: 562]}
dsgvdsgrpigvvpfqwagpgaapediggivaadlrnsgkfnpldrarlpqqpgsaqevq
paawsalgidavvvgqvtpnpdgsynvayqlvdtggapgtvlaqnsykvnkqwlryaght
asdevfekltgikg

SCOPe Domain Coordinates for d1crza2:

Click to download the PDB-style file with coordinates for d1crza2.
(The format of our PDB-style files is described here.)

Timeline for d1crza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1crza1