SCOP 1.69: Domain d1qf6a1: 1qf6 A:533-642

Lineage for d1qf6a1 (1qf6 A:533-642)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family)

5. Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins)

6. Protein Threonyl-tRNA synthetase (ThrRS), C-terminal domain [52962] (2 species)

7. Species Escherichia coli [TaxId:562] [52963] (5 PDB entries)

8. Domain d1qf6a1: 1qf6 A:533-642 [33210]
   Other proteins in same PDB: d1qf6a2, d1qf6a3, d1qf6a4

Details for d1qf6a1

PDB Entry: 1qf6, 2.9 Å

PDB Description: structure of e. coli threonyl-trna synthetase complexed with its cognate trna

SCOP Domain Sequences for d1qf6a1:

Sequence; same for both SEQRES and ATOM records:

>d1qf6a1 c.51.1.1 (A:533-642) Threonyl-tRNA synthetase (ThrRS), C-terminal domain {Escherichia coli}
fptwlapvqvvimnitdsqseyvneltqklsnagirvkadlrnekigfkirehtlrrvpy
mlvcgdkevesgkvavrtrrgkdlgsmdvnevieklqqeirsrslkqlee

Timeline for d1qf6a1:

• d1qf6a1 first appeared (with stable ids) in SCOP 1.55
  
• d1qf6a1 appears in SCOP 1.67
  
• d1qf6a1 appears in SCOP 1.71
  
• d1qf6a1 appears in the current release, SCOPe 2.08