Lineage for d1qf6a1 (1qf6 A:533-642)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 71421Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies)
  4. 71422Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family) (S)
  5. 71423Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (5 proteins)
  6. 71483Protein Threonyl-tRNA synthetase (ThrRS), C-terminal domain [52962] (1 species)
  7. 71484Species Escherichia coli [TaxId:562] [52963] (4 PDB entries)
  8. 71485Domain d1qf6a1: 1qf6 A:533-642 [33210]
    Other proteins in same PDB: d1qf6a2, d1qf6a3, d1qf6a4

Details for d1qf6a1

PDB Entry: 1qf6 (more details), 2.9 Å

PDB Description: structure of e. coli threonyl-trna synthetase complexed with its cognate trna

SCOP Domain Sequences for d1qf6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qf6a1 c.51.1.1 (A:533-642) Threonyl-tRNA synthetase (ThrRS), C-terminal domain {Escherichia coli}
fptwlapvqvvimnitdsqseyvneltqklsnagirvkadlrnekigfkirehtlrrvpy
mlvcgdkevesgkvavrtrrgkdlgsmdvnevieklqqeirsrslkqlee

SCOP Domain Coordinates for d1qf6a1:

Click to download the PDB-style file with coordinates for d1qf6a1.
(The format of our PDB-style files is described here.)

Timeline for d1qf6a1: