Lineage for d1evkb1 (1evk B:533-642)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1856157Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 1856158Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families) (S)
  5. 1856159Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins)
  6. 1856246Protein Threonyl-tRNA synthetase (ThrRS), C-terminal domain [52962] (2 species)
  7. 1856247Species Escherichia coli [TaxId:562] [52963] (5 PDB entries)
  8. 1856256Domain d1evkb1: 1evk B:533-642 [33209]
    Other proteins in same PDB: d1evka2, d1evkb2
    a truncated form of the enzyme
    complexed with thr, zn

Details for d1evkb1

PDB Entry: 1evk (more details), 2 Å

PDB Description: crystal structure of a truncated form of threonyl-trna synthetase with the ligand threonine
PDB Compounds: (B:) threonyl-tRNA synthetase

SCOPe Domain Sequences for d1evkb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1evkb1 c.51.1.1 (B:533-642) Threonyl-tRNA synthetase (ThrRS), C-terminal domain {Escherichia coli [TaxId: 562]}
fptwlapvqvvimnitdsqseyvneltqklsnagirvkadlrnekigfkirehtlrrvpy
mlvcgdkevesgkvavrtrrgkdlgsmdvnevieklqqeirsrslkqlee

SCOPe Domain Coordinates for d1evkb1:

Click to download the PDB-style file with coordinates for d1evkb1.
(The format of our PDB-style files is described here.)

Timeline for d1evkb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1evkb2