SCOP 1.73: Domain d1evka1: 1evk A:533-642

Lineage for d1evka1 (1evk A:533-642)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (5 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.1: Class II aaRS ABD-related [52954] (2 families)

5. Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins)

6. Protein Threonyl-tRNA synthetase (ThrRS), C-terminal domain [52962] (2 species)

7. Species Escherichia coli [TaxId:562] [52963] (5 PDB entries)

8. Domain d1evka1: 1evk A:533-642 [33208]
   Other proteins in same PDB: d1evka2, d1evkb2

Details for d1evka1

PDB Entry: 1evk, 2 Å

PDB Description: crystal structure of a truncated form of threonyl-trna synthetase with the ligand threonine

PDB Compounds: (A:) threonyl-tRNA synthetase

SCOP Domain Sequences for d1evka1:

Sequence; same for both SEQRES and ATOM records:

>d1evka1 c.51.1.1 (A:533-642) Threonyl-tRNA synthetase (ThrRS), C-terminal domain {Escherichia coli [TaxId: 562]}
fptwlapvqvvimnitdsqseyvneltqklsnagirvkadlrnekigfkirehtlrrvpy
mlvcgdkevesgkvavrtrrgkdlgsmdvnevieklqqeirsrslkqlee

Timeline for d1evka1:

• d1evka1 first appeared (with stable ids) in SCOP 1.55
  
• d1evka1 appears in SCOP 1.71
  
• d1evka1 appears in SCOP 1.75
  
• d1evka1 appears in the current release, SCOPe 2.08