Lineage for d5jopd2 (5jop D:108-213)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2029182Protein automated matches [190374] (16 species)
    not a true protein
  7. 2030580Species Mouse (Mus musculus) [TaxId:10090] [224855] (498 PDB entries)
  8. 2030768Domain d5jopd2: 5jop D:108-213 [332073]
    Other proteins in same PDB: d5jopd1, d5jopl1
    automated match to d1tqbc2
    complexed with bgc, gal, gol, nag, po4

Details for d5jopd2

PDB Entry: 5jop (more details), 1.75 Å

PDB Description: crystal structure of anti-glycan antibody fab14.22 in complex with streptococcus pneumoniae serotype 14 tetrasaccharide at 1.75 a
PDB Compounds: (D:) Fab 14.22 light chain

SCOPe Domain Sequences for d5jopd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jopd2 b.1.1.2 (D:108-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOPe Domain Coordinates for d5jopd2:

Click to download the PDB-style file with coordinates for d5jopd2.
(The format of our PDB-style files is described here.)

Timeline for d5jopd2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5jopd1