SCOPe 2.02: Domain d1fyfb1: 1fyf B:533-642

Lineage for d1fyfb1 (1fyf B:533-642)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.1: Class II aaRS ABD-related [52954] (2 families)

5. Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins)

6. Protein Threonyl-tRNA synthetase (ThrRS), C-terminal domain [52962] (2 species)

7. Species Escherichia coli [TaxId:562] [52963] (5 PDB entries)

8. Domain d1fyfb1: 1fyf B:533-642 [33207]
   Other proteins in same PDB: d1fyfa2, d1fyfb2
   a truncated form of the enzyme
   protein/RNA complex; complexed with ssa, zn

Details for d1fyfb1

PDB Entry: 1fyf, 1.65 Å

PDB Description: crystal structure of a truncated form of threonyl-trna synthetase complexed with a seryl adenylate analog

PDB Compounds: (B:) threonyl-tRNA synthetase

SCOPe Domain Sequences for d1fyfb1:

Sequence; same for both SEQRES and ATOM records:

>d1fyfb1 c.51.1.1 (B:533-642) Threonyl-tRNA synthetase (ThrRS), C-terminal domain {Escherichia coli [TaxId: 562]}
fptwlapvqvvimnitdsqseyvneltqklsnagirvkadlrnekigfkirehtlrrvpy
mlvcgdkevesgkvavrtrrgkdlgsmdvnevieklqqeirsrslkqlee

Timeline for d1fyfb1:

• d1fyfb1 first appeared (with stable ids) in SCOP 1.55
  
• d1fyfb1 appears in SCOPe 2.01
  
• d1fyfb1 appears in SCOPe 2.03
  
• d1fyfb1 appears in the current release, SCOPe 2.08