SCOP 1.55: Domain d1fyfb1: 1fyf B:533-642

Lineage for d1fyfb1 (1fyf B:533-642)

1. Root: SCOP 1.55

2. Class c: Alpha and beta proteins (a/b) [51349] (97 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies)

4. Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family)

5. Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (3 proteins)

6. Protein Threonyl-tRNA synthetase (ThrRS), C-terminal domain [52962] (1 species)

7. Species Escherichia coli [TaxId:562] [52963] (4 PDB entries)

8. Domain d1fyfb1: 1fyf B:533-642 [33207]
   Other proteins in same PDB: d1fyfa2, d1fyfb2

Details for d1fyfb1

PDB Entry: 1fyf, 1.65 Å

PDB Description: crystal structure of a truncated form of threonyl-trna synthetase complexed with a seryl adenylate analog

SCOP Domain Sequences for d1fyfb1:

Sequence; same for both SEQRES and ATOM records:

>d1fyfb1 c.51.1.1 (B:533-642) Threonyl-tRNA synthetase (ThrRS), C-terminal domain {Escherichia coli}
fptwlapvqvvimnitdsqseyvneltqklsnagirvkadlrnekigfkirehtlrrvpy
mlvcgdkevesgkvavrtrrgkdlgsmdvnevieklqqeirsrslkqlee

Timeline for d1fyfb1:

• d1fyfb1 appears in SCOP 1.57
  
• d1fyfb1 appears in the current release, SCOPe 2.08