| Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
| Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies) |
Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family) ![]() |
| Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (3 proteins) |
| Protein Threonyl-tRNA synthetase (ThrRS), C-terminal domain [52962] (1 species) |
| Species Escherichia coli [TaxId:562] [52963] (4 PDB entries) |
| Domain d1fyfa1: 1fyf A:533-642 [33206] Other proteins in same PDB: d1fyfa2, d1fyfb2 |
PDB Entry: 1fyf (more details), 1.65 Å
SCOP Domain Sequences for d1fyfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fyfa1 c.51.1.1 (A:533-642) Threonyl-tRNA synthetase (ThrRS), C-terminal domain {Escherichia coli}
fptwlapvqvvimnitdsqseyvneltqklsnagirvkadlrnekigfkirehtlrrvpy
mlvcgdkevesgkvavrtrrgkdlgsmdvnevieklqqeirsrslkqlee
Timeline for d1fyfa1: