Lineage for d1evlc1 (1evl C:533-642)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2881870Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 2881871Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families) (S)
  5. 2881872Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins)
  6. 2881959Protein Threonyl-tRNA synthetase (ThrRS), C-terminal domain [52962] (2 species)
  7. 2881960Species Escherichia coli [TaxId:562] [52963] (5 PDB entries)
  8. 2881964Domain d1evlc1: 1evl C:533-642 [33204]
    Other proteins in same PDB: d1evla2, d1evlb2, d1evlc2, d1evld2
    a truncated form of the enzyme
    complexed with tsb, zn

Details for d1evlc1

PDB Entry: 1evl (more details), 1.55 Å

PDB Description: crystal structure of a truncated form of threonyl-trna synthetase with a threonyl adenylate analog
PDB Compounds: (C:) threonyl-tRNA synthetase

SCOPe Domain Sequences for d1evlc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1evlc1 c.51.1.1 (C:533-642) Threonyl-tRNA synthetase (ThrRS), C-terminal domain {Escherichia coli [TaxId: 562]}
fptwlapvqvvimnitdsqseyvneltqklsnagirvkadlrnekigfkirehtlrrvpy
mlvcgdkevesgkvavrtrrgkdlgsmdvnevieklqqeirsrslkqlee

SCOPe Domain Coordinates for d1evlc1:

Click to download the PDB-style file with coordinates for d1evlc1.
(The format of our PDB-style files is described here.)

Timeline for d1evlc1: