Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families) |
Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins) |
Protein Threonyl-tRNA synthetase (ThrRS), C-terminal domain [52962] (2 species) |
Species Escherichia coli [TaxId:562] [52963] (5 PDB entries) |
Domain d1evlb1: 1evl B:533-642 [33203] Other proteins in same PDB: d1evla2, d1evlb2, d1evlc2, d1evld2 a truncated form of the enzyme complexed with tsb, zn |
PDB Entry: 1evl (more details), 1.55 Å
SCOPe Domain Sequences for d1evlb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1evlb1 c.51.1.1 (B:533-642) Threonyl-tRNA synthetase (ThrRS), C-terminal domain {Escherichia coli [TaxId: 562]} fptwlapvqvvimnitdsqseyvneltqklsnagirvkadlrnekigfkirehtlrrvpy mlvcgdkevesgkvavrtrrgkdlgsmdvnevieklqqeirsrslkqlee
Timeline for d1evlb1: