SCOPe 2.01: Domain d1evla1: 1evl A:533-642

Lineage for d1evla1 (1evl A:533-642)

Root: SCOPe 2.01
Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
Superfamily c.51.1: Class II aaRS ABD-related [52954] (2 families)
Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins)
Protein Threonyl-tRNA synthetase (ThrRS), C-terminal domain [52962] (2 species)
Species Escherichia coli [TaxId:562] [52963] (5 PDB entries)
Domain d1evla1: 1evl A:533-642 [33202]
Other proteins in same PDB: d1evla2, d1evlb2, d1evlc2, d1evld2
a truncated form of the enzyme
complexed with tsb, zn

Details for d1evla1

PDB Entry: 1evl (more details), 1.55 Å

PDB Description: crystal structure of a truncated form of threonyl-trna synthetase with a threonyl adenylate analog

PDB Compounds: (A:) threonyl-tRNA synthetase

SCOPe Domain Sequences for d1evla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1evla1 c.51.1.1 (A:533-642) Threonyl-tRNA synthetase (ThrRS), C-terminal domain {Escherichia coli [TaxId: 562]}
fptwlapvqvvimnitdsqseyvneltqklsnagirvkadlrnekigfkirehtlrrvpy
mlvcgdkevesgkvavrtrrgkdlgsmdvnevieklqqeirsrslkqlee

SCOPe Domain Coordinates for d1evla1:

Click to download the PDB-style file with coordinates for d1evla1.
(The format of our PDB-style files is described here.)

Timeline for d1evla1: