SCOP 1.55: Domain d1evla1: 1evl A:533-642

Lineage for d1evla1 (1evl A:533-642)

1. Root: SCOP 1.55

2. Class c: Alpha and beta proteins (a/b) [51349] (97 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies)

4. Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family)

5. Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (3 proteins)

6. Protein Threonyl-tRNA synthetase (ThrRS), C-terminal domain [52962] (1 species)

7. Species Escherichia coli [TaxId:562] [52963] (4 PDB entries)

8. Domain d1evla1: 1evl A:533-642 [33202]
   Other proteins in same PDB: d1evla2, d1evlb2, d1evlc2, d1evld2

Details for d1evla1

PDB Entry: 1evl, 1.55 Å

PDB Description: crystal structure of a truncated form of threonyl-trna synthetase with a threonyl adenylate analog

SCOP Domain Sequences for d1evla1:

Sequence; same for both SEQRES and ATOM records:

>d1evla1 c.51.1.1 (A:533-642) Threonyl-tRNA synthetase (ThrRS), C-terminal domain {Escherichia coli}
fptwlapvqvvimnitdsqseyvneltqklsnagirvkadlrnekigfkirehtlrrvpy
mlvcgdkevesgkvavrtrrgkdlgsmdvnevieklqqeirsrslkqlee

Timeline for d1evla1:

• d1evla1 appears in SCOP 1.57
  
• d1evla1 appears in the current release, SCOPe 2.08