SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1evla1 (1evl A:533-642)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2120781Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 2120782Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families) (S)
  5. 2120783Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 protein domains)
  6. 2120870Protein Threonyl-tRNA synthetase (ThrRS), C-terminal domain [52962] (2 species)
  7. 2120871Species Escherichia coli [TaxId:562] [52963] (5 PDB entries)
  8. 2120873Domain d1evla1: 1evl A:533-642 [33202]
    Other proteins in same PDB: d1evla2, d1evlb2, d1evlc2, d1evld2
    a truncated form of the enzyme
    complexed with tsb, zn

Details for d1evla1

PDB Entry: 1evl (more details), 1.55 Å

PDB Description: crystal structure of a truncated form of threonyl-trna synthetase with a threonyl adenylate analog
PDB Compounds: (A:) threonyl-tRNA synthetase

SCOPe Domain Sequences for d1evla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1evla1 c.51.1.1 (A:533-642) Threonyl-tRNA synthetase (ThrRS), C-terminal domain {Escherichia coli [TaxId: 562]}
fptwlapvqvvimnitdsqseyvneltqklsnagirvkadlrnekigfkirehtlrrvpy
mlvcgdkevesgkvavrtrrgkdlgsmdvnevieklqqeirsrslkqlee

SCOPe Domain Coordinates for d1evla1:

Click to download the PDB-style file with coordinates for d1evla1.
(The format of our PDB-style files is described here.)

Timeline for d1evla1: