SCOP 1.57: Domain d1atia1: 1ati A:395-505

Lineage for d1atia1 (1ati A:395-505)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies)

4. Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family)

5. Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (5 proteins)

6. Protein Glycyl-tRNA synthetase (GlyRS), C-terminal domain [52960] (1 species)

7. Species Thermus thermophilus [TaxId:274] [52961] (3 PDB entries)

8. Domain d1atia1: 1ati A:395-505 [33196]
   Other proteins in same PDB: d1atia2, d1atib2

Details for d1atia1

PDB Entry: 1ati, 2.75 Å

PDB Description: crystal structure of glycyl-trna synthetase from thermus thermophilus

SCOP Domain Sequences for d1atia1:

Sequence; same for both SEQRES and ATOM records:

>d1atia1 c.51.1.1 (A:395-505) Glycyl-tRNA synthetase (GlyRS), C-terminal domain {Thermus thermophilus}
qlapikvaviplvknrpeiteyakrlkarllalglgrvlyedtgnigkayrrhdevgtpf
avtvdydtigqskdgttrlkdtvtvrdrdtmeqirlhvdelegflrerlrw

Timeline for d1atia1:

• d1atia1 first appeared (with stable ids) in SCOP 1.55
  
• d1atia1 appears in SCOP 1.59
  
• d1atia1 appears in the current release, SCOPe 2.08