SCOPe 2.08: Domain d5pd2a1: 5pd2 A:1858-1970

Lineage for d5pd2a1 (5pd2 A:1858-1970)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (1052 PDB entries)

8. Domain d5pd2a1: 5pd2 A:1858-1970 [331950]
   Other proteins in same PDB: d5pd2a2
   automated match to d3uv2a_
   complexed with edo

Details for d5pd2a1

PDB Entry: 5pd2, 1.79 Å

PDB Description: pandda analysis group deposition -- crystal structure of baz2b after initial refinement with no ligand modelled (structure 58)

PDB Compounds: (A:) Bromodomain adjacent to zinc finger domain protein 2B

SCOPe Domain Sequences for d5pd2a1:

Sequence; same for both SEQRES and ATOM records:

>d5pd2a1 a.29.2.0 (A:1858-1970) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svkkpkrddskdlalcsmiltemethedawpfllpvnlklvpgykkvikkpmdfstirek
lssgqypnletfaldvrlvfdncetfneddsdigraghnmrkyfekkwtdtfk

Timeline for d5pd2a1:

• d5pd2a1 first appeared in SCOPe 2.06
  
• d5pd2a1 appears in SCOPe 2.07