Lineage for d1adya1 (1ady A:326-421)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2489766Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 2489767Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families) (S)
  5. 2489768Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins)
  6. 2489777Protein Histidyl-tRNA synthetase (HisRS), C-terminal domain [52956] (4 species)
  7. 2489801Species Thermus thermophilus [TaxId:274] [52959] (3 PDB entries)
  8. 2489807Domain d1adya1: 1ady A:326-421 [33192]
    Other proteins in same PDB: d1adya2, d1adyb2, d1adyc2, d1adyd2
    protein/RNA complex; complexed with ham, so4

Details for d1adya1

PDB Entry: 1ady (more details), 2.8 Å

PDB Description: histidyl-trna synthetase in complex with histidyl-adenylate
PDB Compounds: (A:) histidyl-tRNA synthetase

SCOPe Domain Sequences for d1adya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1adya1 c.51.1.1 (A:326-421) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Thermus thermophilus [TaxId: 274]}
ekgpdlyliplteeavaeafylaealrprlraeyalaprkpakgleealkrgaafagflg
edelragevtlkrlatgeqvrlsreevpgyllqalg

SCOPe Domain Coordinates for d1adya1:

Click to download the PDB-style file with coordinates for d1adya1.
(The format of our PDB-style files is described here.)

Timeline for d1adya1: