Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
Superfamily c.51.1: Class II aaRS ABD-related [52954] (2 families) |
Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins) |
Protein Histidyl-tRNA synthetase (HisRS), C-terminal domain [52956] (4 species) |
Species Thermus thermophilus [TaxId:274] [52959] (3 PDB entries) |
Domain d1adjd1: 1adj D:326-421 [33191] Other proteins in same PDB: d1adja2, d1adjb2, d1adjc2, d1adjd2 protein/RNA complex; complexed with his, so4 |
PDB Entry: 1adj (more details), 2.7 Å
SCOPe Domain Sequences for d1adjd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1adjd1 c.51.1.1 (D:326-421) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Thermus thermophilus [TaxId: 274]} ekgpdlyliplteeavaeafylaealrprlraeyalaprkpakgleealkrgaafagflg edelragevtlkrlatgeqvrlsreevpgyllqalg
Timeline for d1adjd1: