Lineage for d1adjd1 (1adj D:326-421)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1170330Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 1170331Superfamily c.51.1: Class II aaRS ABD-related [52954] (2 families) (S)
  5. 1170332Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins)
  6. 1170341Protein Histidyl-tRNA synthetase (HisRS), C-terminal domain [52956] (4 species)
  7. 1170365Species Thermus thermophilus [TaxId:274] [52959] (3 PDB entries)
  8. 1170370Domain d1adjd1: 1adj D:326-421 [33191]
    Other proteins in same PDB: d1adja2, d1adjb2, d1adjc2, d1adjd2
    protein/RNA complex; complexed with his, so4

Details for d1adjd1

PDB Entry: 1adj (more details), 2.7 Å

PDB Description: histidyl-trna synthetase in complex with histidine
PDB Compounds: (D:) histidyl-tRNA synthetase

SCOPe Domain Sequences for d1adjd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1adjd1 c.51.1.1 (D:326-421) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Thermus thermophilus [TaxId: 274]}
ekgpdlyliplteeavaeafylaealrprlraeyalaprkpakgleealkrgaafagflg
edelragevtlkrlatgeqvrlsreevpgyllqalg

SCOPe Domain Coordinates for d1adjd1:

Click to download the PDB-style file with coordinates for d1adjd1.
(The format of our PDB-style files is described here.)

Timeline for d1adjd1: