Lineage for d1adjc1 (1adj C:326-421)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families) 
Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins) 
Protein Histidyl-tRNA synthetase (HisRS), C-terminal domain [52956] (4 species) Species Thermus thermophilus [TaxId:274] [52959] (3 PDB entries) 
Domain d1adjc1: 1adj C:326-421 [33190]
Other proteins in same PDB: d1adja2, d1adjb2, d1adjc2, d1adjd2
protein/RNA complex; complexed with his, so4
Details for d1adjc1
PDB Entry: 1adj (more details), 2.7 Å
PDB Description: histidyl-trna synthetase in complex with histidine
PDB Compounds: (C:) histidyl-tRNA synthetaseSCOPe Domain Sequences for d1adjc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1adjc1 c.51.1.1 (C:326-421) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Thermus thermophilus [TaxId: 274]}
ekgpdlyliplteeavaeafylaealrprlraeyalaprkpakgleealkrgaafagflg
edelragevtlkrlatgeqvrlsreevpgyllqalg
SCOPe Domain Coordinates for d1adjc1:
Click to download the PDB-style file with coordinates for d1adjc1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1adjc1:
View in 3D
