Lineage for d5jorl2 (5jor L:108-213)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2752810Domain d5jorl2: 5jor L:108-213 [331893]
    Other proteins in same PDB: d5jora1, d5jorc1, d5jore1, d5jorl1
    automated match to d1tqbc2
    complexed with 1pe, gol, so4

Details for d5jorl2

PDB Entry: 5jor (more details), 2.21 Å

PDB Description: crystal structure of unbound anti-glycan antibody fab14.22 at 2.2 a
PDB Compounds: (L:) Fab 14.22 light chain

SCOPe Domain Sequences for d5jorl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jorl2 b.1.1.2 (L:108-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOPe Domain Coordinates for d5jorl2:

Click to download the PDB-style file with coordinates for d5jorl2.
(The format of our PDB-style files is described here.)

Timeline for d5jorl2: