Lineage for d1adjb1 (1adj B:326-421)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 835189Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 835190Superfamily c.51.1: Class II aaRS ABD-related [52954] (2 families) (S)
  5. 835191Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins)
  6. 835200Protein Histidyl-tRNA synthetase (HisRS), C-terminal domain [52956] (4 species)
  7. 835224Species Thermus thermophilus [TaxId:274] [52959] (3 PDB entries)
  8. 835227Domain d1adjb1: 1adj B:326-421 [33189]
    Other proteins in same PDB: d1adja2, d1adjb2, d1adjc2, d1adjd2

Details for d1adjb1

PDB Entry: 1adj (more details), 2.7 Å

PDB Description: histidyl-trna synthetase in complex with histidine
PDB Compounds: (B:) histidyl-tRNA synthetase

SCOP Domain Sequences for d1adjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1adjb1 c.51.1.1 (B:326-421) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Thermus thermophilus [TaxId: 274]}
ekgpdlyliplteeavaeafylaealrprlraeyalaprkpakgleealkrgaafagflg
edelragevtlkrlatgeqvrlsreevpgyllqalg

SCOP Domain Coordinates for d1adjb1:

Click to download the PDB-style file with coordinates for d1adjb1.
(The format of our PDB-style files is described here.)

Timeline for d1adjb1: