SCOP 1.73: Domain d1qe0b1: 1qe0 B:326-419

Lineage for d1qe0b1 (1qe0 B:326-419)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (5 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.1: Class II aaRS ABD-related [52954] (2 families)

5. Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins)

6. Protein Histidyl-tRNA synthetase (HisRS), C-terminal domain [52956] (4 species)

7. Species Staphylococcus aureus [TaxId:1280] [52958] (1 PDB entry)

8. Domain d1qe0b1: 1qe0 B:326-419 [33187]
   Other proteins in same PDB: d1qe0a2, d1qe0b2

Details for d1qe0b1

PDB Entry: 1qe0, 2.7 Å

PDB Description: crystal structure of apo s. aureus histidyl-trna synthetase

PDB Compounds: (B:) histidyl-tRNA synthetase

SCOP Domain Sequences for d1qe0b1:

Sequence; same for both SEQRES and ATOM records:

>d1qe0b1 c.51.1.1 (B:326-419) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Staphylococcus aureus [TaxId: 1280]}
ieenldlfivtmgdqadryavkllnhlrhngikadkdylqrkikgqmkqadrlgakftiv
igdqelennkidvknmttgesetieldalveyfk

Timeline for d1qe0b1:

• d1qe0b1 first appeared (with stable ids) in SCOP 1.55
  
• d1qe0b1 appears in SCOP 1.71
  
• d1qe0b1 appears in SCOP 1.75
  
• d1qe0b1 appears in the current release, SCOPe 2.08