Lineage for d5lxgl_ (5lxg L:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2745218Domain d5lxgl_: 5lxg L: [331869]
    automated match to d3wxwl_
    complexed with so4, zn

Details for d5lxgl_

PDB Entry: 5lxg (more details), 2.73 Å

PDB Description: revised crystal structure of the human adiponectin receptor 1 in an open conformation
PDB Compounds: (L:) V region light chain

SCOPe Domain Sequences for d5lxgl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lxgl_ b.1.1.1 (L:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diqmtqspaslsasvgetvtitcrasgnihnflawyqqkqgkspqvlvynaktladgvps
rfsgsgsgtqyslkinslqpedfgsyycqqfwstpytfgggtklein

SCOPe Domain Coordinates for d5lxgl_:

Click to download the PDB-style file with coordinates for d5lxgl_.
(The format of our PDB-style files is described here.)

Timeline for d5lxgl_: