SCOPe 2.02: Domain d1qe0a1: 1qe0 A:326-420

Lineage for d1qe0a1 (1qe0 A:326-420)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.1: Class II aaRS ABD-related [52954] (2 families)

5. Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins)

6. Protein Histidyl-tRNA synthetase (HisRS), C-terminal domain [52956] (4 species)

7. Species Staphylococcus aureus [TaxId:1280] [52958] (1 PDB entry)

8. Domain d1qe0a1: 1qe0 A:326-420 [33186]
   Other proteins in same PDB: d1qe0a2, d1qe0b2

Details for d1qe0a1

PDB Entry: 1qe0, 2.7 Å

PDB Description: crystal structure of apo s. aureus histidyl-trna synthetase

PDB Compounds: (A:) histidyl-tRNA synthetase

SCOPe Domain Sequences for d1qe0a1:

Sequence; same for both SEQRES and ATOM records:

>d1qe0a1 c.51.1.1 (A:326-420) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Staphylococcus aureus [TaxId: 1280]}
ieenldlfivtmgdqadryavkllnhlrhngikadkdylqrkikgqmkqadrlgakftiv
igdqelennkidvknmttgesetieldalveyfkk

Timeline for d1qe0a1:

• d1qe0a1 first appeared (with stable ids) in SCOP 1.55
  
• d1qe0a1 appears in SCOPe 2.01
  
• d1qe0a1 appears in SCOPe 2.03
  
• d1qe0a1 appears in the current release, SCOPe 2.08