Lineage for d1kmnd1 (1kmn D:326-424)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2881870Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 2881871Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families) (S)
  5. 2881872Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins)
  6. 2881881Protein Histidyl-tRNA synthetase (HisRS), C-terminal domain [52956] (4 species)
  7. 2881882Species Escherichia coli [TaxId:562] [52957] (4 PDB entries)
  8. 2881898Domain d1kmnd1: 1kmn D:326-424 [33185]
    Other proteins in same PDB: d1kmna2, d1kmnb2, d1kmnc2, d1kmnd2
    protein/RNA complex; complexed with atp, hso

Details for d1kmnd1

PDB Entry: 1kmn (more details), 2.8 Å

PDB Description: histidyl-trna synthetase complexed with histidinol and atp
PDB Compounds: (D:) histidyl-tRNA synthetase

SCOPe Domain Sequences for d1kmnd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kmnd1 c.51.1.1 (D:326-424) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Escherichia coli [TaxId: 562]}
dpvvdiylvasgadtqsaamalaerlrdelpgvklmtnhgggnfkkqfaradkwgarvav
vlgesevangtavvkdlrsgeqtavaqdsvaahlrtllg

SCOPe Domain Coordinates for d1kmnd1:

Click to download the PDB-style file with coordinates for d1kmnd1.
(The format of our PDB-style files is described here.)

Timeline for d1kmnd1: