SCOP 1.73: Domain d1kmnc1: 1kmn C:326-424

Lineage for d1kmnc1 (1kmn C:326-424)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (5 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.1: Class II aaRS ABD-related [52954] (2 families)

5. Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins)

6. Protein Histidyl-tRNA synthetase (HisRS), C-terminal domain [52956] (4 species)

7. Species Escherichia coli [TaxId:562] [52957] (3 PDB entries)

8. Domain d1kmnc1: 1kmn C:326-424 [33184]
   Other proteins in same PDB: d1kmna2, d1kmnb2, d1kmnc2, d1kmnd2

Details for d1kmnc1

PDB Entry: 1kmn, 2.8 Å

PDB Description: histidyl-trna synthetase complexed with histidinol and atp

PDB Compounds: (C:) histidyl-tRNA synthetase

SCOP Domain Sequences for d1kmnc1:

Sequence; same for both SEQRES and ATOM records:

>d1kmnc1 c.51.1.1 (C:326-424) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Escherichia coli [TaxId: 562]}
dpvvdiylvasgadtqsaamalaerlrdelpgvklmtnhgggnfkkqfaradkwgarvav
vlgesevangtavvkdlrsgeqtavaqdsvaahlrtllg

Timeline for d1kmnc1:

• d1kmnc1 first appeared (with stable ids) in SCOP 1.55
  
• d1kmnc1 appears in SCOP 1.71
  
• d1kmnc1 appears in SCOP 1.75
  
• d1kmnc1 appears in the current release, SCOPe 2.08