Lineage for d1kmnb1 (1kmn B:326-424)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 316208Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 316209Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family) (S)
  5. 316210Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (5 proteins)
  6. 316219Protein Histidyl-tRNA synthetase (HisRS), C-terminal domain [52956] (3 species)
  7. 316220Species Escherichia coli [TaxId:562] [52957] (3 PDB entries)
  8. 316230Domain d1kmnb1: 1kmn B:326-424 [33183]
    Other proteins in same PDB: d1kmna2, d1kmnb2, d1kmnc2, d1kmnd2

Details for d1kmnb1

PDB Entry: 1kmn (more details), 2.8 Å

PDB Description: histidyl-trna synthetase complexed with histidinol and atp

SCOP Domain Sequences for d1kmnb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kmnb1 c.51.1.1 (B:326-424) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Escherichia coli}
dpvvdiylvasgadtqsaamalaerlrdelpgvklmtnhgggnfkkqfaradkwgarvav
vlgesevangtavvkdlrsgeqtavaqdsvaahlrtllg

SCOP Domain Coordinates for d1kmnb1:

Click to download the PDB-style file with coordinates for d1kmnb1.
(The format of our PDB-style files is described here.)

Timeline for d1kmnb1: